Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 4 (GPR4)

This Recombinant Human G-protein coupled receptor 4 (GPR4) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

G-protein coupled receptor 4, G-protein coupled receptor 19

UniProt

P46093

Expression Region

1-362

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNHTWEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVQQRNELGVYLMNLS IADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVA HPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMEGWVAW MNLYRVFVGFLFPWALMLLSYRGILRAVRGSVSTERQEKAKIKRLALSLIAIVLVCFAPY HVLLLSRSAIYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVAKA LHNLLRFLASDKPQEMANASLTLETPLTSKRNSTAKAMTGSWAATPPSQGDQVQLKMLPP AQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ARL2BP Antibody [CoraFluor 1]
NBP3-00281CL1 0.1 mL

Rabbit Polyclonal ARL2BP Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Research Grade Anti-Human CD357/TNFRSF18/GITR (MK1248)
DHK27804 100 μg

Research Grade Anti-Human CD357/TNFRSF18/GITR (MK1248)

Sign In for Pricing
View Details
Recombinant Paraoxonase 1 (PON1)
MBS2031825-01 0.01 mg

Recombinant Paraoxonase 1 (PON1)

Sign In for Pricing
View Details
Recombinant Paraoxonase 1 (PON1)
MBS2031825-02 0.05 mg

Recombinant Paraoxonase 1 (PON1)

Sign In for Pricing
View Details
Recombinant Paraoxonase 1 (PON1)
MBS2031825-03 0.1 mg

Recombinant Paraoxonase 1 (PON1)

Sign In for Pricing
View Details
Recombinant Paraoxonase 1 (PON1)
MBS2031825-04 0.2 mg

Recombinant Paraoxonase 1 (PON1)

Sign In for Pricing
View Details