Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cell division protein FtsX (ftsX)

This Recombinant Cell division protein FtsX (ftsX) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Cell division protein FtsX

UniProt

P0AC32

Expression Region

1-352

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAF HGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLD DDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKL DFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVI GNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSS AVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orion Star A123 Dissolved Oxygen Portable Meter 3 m Cable Kit
STARA1236 1 Each

Orion Star A123 Dissolved Oxygen Portable Meter 3 m Cable Kit

Sign In for Pricing
View Details
Anti-Calcium Sensing Receptor/CASR Antibody Picoband® (Dylight594 Conjugate)
PB9924-Dylight594 100 µg

Anti-Calcium Sensing Receptor/CASR Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
RPS9 Antibody
E93242 100 µg

RPS9 Antibody

Sign In for Pricing
View Details
Human RNase H1 (RNASEH1) activation kit by CRISPRa
GA116723 1 Kit

Human RNase H1 (RNASEH1) activation kit by CRISPRa

Sign In for Pricing
View Details
Meteorin CRISPR Activation Plasmid (h)
sc-409321-ACT 20 µg

Meteorin CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
CYP2E1 Rabbit Polyclonal Antibody
orb327442 100 µL

CYP2E1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details