Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cell division protein FtsX (ftsX)

This Recombinant Cell division protein FtsX (ftsX) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Cell division protein FtsX

UniProt

P0AC32

Expression Region

1-352

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKRDAINHIRQFGGRLDRFRKSVGGSGDGGRNAPKRAKSSPKPVNRKTNVFNEQVRYAF HGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTLD DDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKL DFQGTESLNTLRDRITQINGIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVI GNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLSS AVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Adenomatous polyposis coli protein ELISA Kit
EK2733 Inquire

Human Adenomatous polyposis coli protein ELISA Kit

Sign In for Pricing
View Details
BDE 197 [CAS:117964-21-3] 10ug/ml in Iso-octane
BDE19701ZT10 10 mL

BDE 197 [CAS:117964-21-3] 10ug/ml in Iso-octane

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Pentatricopeptide repeat-containing protein At5g42310, mitochondrial (At5g42310) , partial
MBS1283261 Inquire

Recombinant Arabidopsis thaliana Pentatricopeptide repeat-containing protein At5g42310, mitochondrial (At5g42310) , partial

Sign In for Pricing
View Details
Human PON1/Serum paraoxonase/arylesterase 1 ELISA Kit
E1989Hu 96 Tests

Human PON1/Serum paraoxonase/arylesterase 1 ELISA Kit

Sign In for Pricing
View Details
IZUMO1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
25219156 3x 1.0 µg DNA

IZUMO1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
RBP4 Antibody
CSB-PA272372-01 50 μL

RBP4 Antibody

Sign In for Pricing
View Details