Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q67867

Expression Region

2-400

Origin

Hepatitis B virus genotype C subtype adr (isolate Korea/Kim/1989) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDRWPEANQVGAG AFGPGYPPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQ WNSTTFHQVLLDPRVRGLYFPPGGSSSGTVNPVPTTASPISSISSRTGDPAPNMESTTSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIP AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEGASVRFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human TMEM126A (Transmembrane protein 126A) Full Length
MPC1528K Each

Magic™ Membrane Protein Human TMEM126A (Transmembrane protein 126A) Full Length

Sign In for Pricing
View Details
anti-MGC4172
YF-PA20769 100 ug

anti-MGC4172

Sign In for Pricing
View Details
pCMV-SPORT6-C13H20orf85 Plasmid
PVT36104 2 µg

pCMV-SPORT6-C13H20orf85 Plasmid

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri YBJH Polyclonal Antibody
MBS7165658 Inquire

Rabbit anti-Shigella flexneri YBJH Polyclonal Antibody

Sign In for Pricing
View Details
MPPED2 Lentiviral Activation Particles (m2)
sc-429481-LAC-2 200 µL

MPPED2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)
MBS1057360 Inquire

Recombinant Escherichia coli O157:H7 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Sign In for Pricing
View Details