Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q67867

Expression Region

2-400

Origin

Hepatitis B virus genotype C subtype adr (isolate Korea/Kim/1989) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDRWPEANQVGAG AFGPGYPPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQ WNSTTFHQVLLDPRVRGLYFPPGGSSSGTVNPVPTTASPISSISSRTGDPAPNMESTTSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIP AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEGASVRFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAXX Rabbit Polyclonal Antibody
AP06384PU-N 100 µg

DAXX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fibronectin (FN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F9]
TA803782AM 100 µL

Fibronectin (FN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F9]

Sign In for Pricing
View Details
RYR1 Rabbit Polyclonal Antibody
ER1803-19 100 µL

RYR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF181 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E4]
TA811419BM 100 µL

ZNF181 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E4]

Sign In for Pricing
View Details
Human LEP Antibody Pair Set
E-KAB-0050 50 µL & 100 µg

Human LEP Antibody Pair Set

Sign In for Pricing
View Details
Txndc12 Mouse Gene Knockout Kit (CRISPR)
KN518509 1 Kit

Txndc12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details