Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q67867

Expression Region

2-400

Origin

Hepatitis B virus genotype C subtype adr (isolate Korea/Kim/1989) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDRWPEANQVGAG AFGPGYPPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQ WNSTTFHQVLLDPRVRGLYFPPGGSSSGTVNPVPTTASPISSISSRTGDPAPNMESTTSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIP AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEGASVRFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Primary Bone Marrow Mononuclear Cells
AFG-ELL-0640 > 5x 10^5 Cells / Vial

Mouse Primary Bone Marrow Mononuclear Cells

Sign In for Pricing
View Details
Human LCN1 (Lipocalin 1) ELISA Kit
RE1255H-01 48 Tests

Human LCN1 (Lipocalin 1) ELISA Kit

Sign In for Pricing
View Details
Human LCN1 (Lipocalin 1) ELISA Kit
RE1255H-02 96 Tests

Human LCN1 (Lipocalin 1) ELISA Kit

Sign In for Pricing
View Details
PAGE2B Antibody
A57221-100UG 100 µg

PAGE2B Antibody

Sign In for Pricing
View Details
NOTCH3 Knockout Cell Lysate
ABC-KC1307 100 µg

NOTCH3 Knockout Cell Lysate

Sign In for Pricing
View Details
Phospho-CFL1 (Ser3) Antibody
A73406-100UL 100 µL

Phospho-CFL1 (Ser3) Antibody

Sign In for Pricing
View Details