Recombinant Magnetospirillum magneticum Electron transport complex protein RnfE (rnfE)
This Recombinant Magnetospirillum magneticum Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-223.
Product Specifications
Product Name Alternative
Electron transport complex protein RnfE, Nitrogen fixation protein RnfE
UniProt
Q2W403
Expression Region
1-223
Origin
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSASYGRIIKDGLWENNGVLCMLLGMCPTMAMTGTATNGLGMGLATAAVMAASNLMVAMF RNYVTHEVRIPVYILIVAANVTFVDLGMNAWMHELYKVLGLFIPLIVSNCLPLARLEAFA AKEPVLPSFLDGLFMGLGFTLALTAIGAVREMIGQGTLFADAALLLGPWAKLLELRVMPA DWGILVLILPPGGFLIAGLMVVAKRLVDLAGGKEIKMAGAHSV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941081-100 1x 100 µL
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details