Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella halifaxensis Cobalamin synthase (cobS)

This Recombinant Shewanella halifaxensis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B0TSP8

Expression Region

1-259

Origin

Shewanella halifaxensis (strain HAW-EB4)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLWQKQLNLFFIAMGFFTRIPMPKWIEVDADKLNKASRYFGLVGLLVGAISAAVYSLML YWVSPSVAIVFAMITSVLVTGGFHEDGLADTADGLGGGWTVEAKLNIMKDSRLGSYGALA LVLALLLKWQLLTELALFDPSSVSLALIVGHCLSRVVAASFIFSEEYVSDTDTSKSKPLA QQQGINELSILLASGVLALLLVGLVPALVLITGLVIVRYGFIRLFRSQIGGYTGDTLGAA QQGSELSCYLLLLILGVSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human T cell receptor alpha variable 41 (TVA41)
orb3010796-01 20 µg

Recombinant Human T cell receptor alpha variable 41 (TVA41)

Sign In for Pricing
View Details
Recombinant Human T cell receptor alpha variable 41 (TVA41)
orb3010796-02 100 µg

Recombinant Human T cell receptor alpha variable 41 (TVA41)

Sign In for Pricing
View Details
Recombinant Human T cell receptor alpha variable 41 (TVA41)
orb3010796-03 1 mg

Recombinant Human T cell receptor alpha variable 41 (TVA41)

Sign In for Pricing
View Details
ERN2 Antibody
8C11246-AAT 50 µg

ERN2 Antibody

Sign In for Pricing
View Details
1-(2-Cyclopropylethyl)-6-fluorobenzo[d][1,3]oxazine-2,4-dione
TRC-C988845-500MG 500 mg

1-(2-Cyclopropylethyl)-6-fluorobenzo[d][1,3]oxazine-2,4-dione

Sign In for Pricing
View Details
Ccr5 Antibody, HRP conjugated
MBS1493917-01 0.05 mg

Ccr5 Antibody, HRP conjugated

Sign In for Pricing
View Details