Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fat storage-inducing transmembrane protein 2 (Fitm2)

This Recombinant Mouse Fat storage-inducing transmembrane protein 2 (Fitm2) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Fat storage-inducing transmembrane protein 2, Fat-inducing protein 2

UniProt

P59266

Expression Region

1-262

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHLERCAWFLRGTLVRATVRRHLPWALVAAMLAGSVVKELSPLPESYLSNKRNVLNVYF VKLAWAWTVCLLLPFIALTNYHLTGKTSLVLRRLSTLLVGTAIWYICTALFSNIEHYTGS CYQSPALEGIRQEHRSKQQCHREGGFWHGFDISGHSFLLTFCALMIVEEMAVLHEVKTDR GHHLHAAITTLVVALGFLTFIWVWMFLCTAVYFHDLTQKVFGTMFGLLGWYGTYGYWYLK SFSPGLPPQSCSLTLKRDTYKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMT-dG (ib) Phosphoramidite-13C10,15N5
HY-W008848S-01 1 mg

DMT-dG (ib) Phosphoramidite-13C10,15N5

Sign In for Pricing
View Details
DMT-dG (ib) Phosphoramidite-13C10,15N5
HY-W008848S-02 5 mg

DMT-dG (ib) Phosphoramidite-13C10,15N5

Sign In for Pricing
View Details
Anti-TIGD1 Antibody
CPA7229-01 30 µL

Anti-TIGD1 Antibody

Sign In for Pricing
View Details
Anti-TIGD1 Antibody
CPA7229-02 50 μL

Anti-TIGD1 Antibody

Sign In for Pricing
View Details
Anti-TIGD1 Antibody
CPA7229-03 100 µL

Anti-TIGD1 Antibody

Sign In for Pricing
View Details
Anti-TIGD1 Antibody
CPA7229-04 200 µL

Anti-TIGD1 Antibody

Sign In for Pricing
View Details