Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fat storage-inducing transmembrane protein 2 (Fitm2)

This Recombinant Mouse Fat storage-inducing transmembrane protein 2 (Fitm2) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Fat storage-inducing transmembrane protein 2, Fat-inducing protein 2

UniProt

P59266

Expression Region

1-262

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHLERCAWFLRGTLVRATVRRHLPWALVAAMLAGSVVKELSPLPESYLSNKRNVLNVYF VKLAWAWTVCLLLPFIALTNYHLTGKTSLVLRRLSTLLVGTAIWYICTALFSNIEHYTGS CYQSPALEGIRQEHRSKQQCHREGGFWHGFDISGHSFLLTFCALMIVEEMAVLHEVKTDR GHHLHAAITTLVVALGFLTFIWVWMFLCTAVYFHDLTQKVFGTMFGLLGWYGTYGYWYLK SFSPGLPPQSCSLTLKRDTYKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF5 ORF Vector (Human) (pORF)
12615011 1.0 µg DNA

ATF5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
APC Anti-Mouse CD36 Antibody[HM36]
FCE3717-01 25 µg

APC Anti-Mouse CD36 Antibody[HM36]

Sign In for Pricing
View Details
APC Anti-Mouse CD36 Antibody[HM36]
FCE3717-02 100 µg

APC Anti-Mouse CD36 Antibody[HM36]

Sign In for Pricing
View Details
PKCµ (PKCmu), GST-tag
40166 10 µg

PKCµ (PKCmu), GST-tag

Sign In for Pricing
View Details
Zeta Chain Associated Protein Kinase 70 kDa Phospho-Tyr493 (ZAP70 pY493) Antibody
abx333317 100 µL

Zeta Chain Associated Protein Kinase 70 kDa Phospho-Tyr493 (ZAP70 pY493) Antibody

Sign In for Pricing
View Details
Mapre2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
28087114 3x 1.0 µg

Mapre2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details