Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fat storage-inducing transmembrane protein 2 (Fitm2)

This Recombinant Mouse Fat storage-inducing transmembrane protein 2 (Fitm2) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Fat storage-inducing transmembrane protein 2, Fat-inducing protein 2

UniProt

P59266

Expression Region

1-262

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHLERCAWFLRGTLVRATVRRHLPWALVAAMLAGSVVKELSPLPESYLSNKRNVLNVYF VKLAWAWTVCLLLPFIALTNYHLTGKTSLVLRRLSTLLVGTAIWYICTALFSNIEHYTGS CYQSPALEGIRQEHRSKQQCHREGGFWHGFDISGHSFLLTFCALMIVEEMAVLHEVKTDR GHHLHAAITTLVVALGFLTFIWVWMFLCTAVYFHDLTQKVFGTMFGLLGWYGTYGYWYLK SFSPGLPPQSCSLTLKRDTYKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EIF4E3 Antibody
A13024-1 100 µL

Anti-EIF4E3 Antibody

Sign In for Pricing
View Details
RPS24P12 ORF Vector (Human) (pORF)
ORF031396 1.0 µg DNA

RPS24P12 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PEX5 Peptide - N-terminal region
orb2012821 100 µg

PEX5 Peptide - N-terminal region

Sign In for Pricing
View Details
RPS3A Protein Lysate (Human) with C-Ha Tag
42496031 100 µg

RPS3A Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Ubiquitin-conjugating enzyme E2 Q2 Antibody (FITC)
abx107464-01 20 µg

Ubiquitin-conjugating enzyme E2 Q2 Antibody (FITC)

Sign In for Pricing
View Details
Ubiquitin-conjugating enzyme E2 Q2 Antibody (FITC)
abx107464-02 50 µg

Ubiquitin-conjugating enzyme E2 Q2 Antibody (FITC)

Sign In for Pricing
View Details