What is the catalog number for Recombinant Mannose permease IIC component (manY)?

The catalog number for Recombinant Mannose permease IIC component (manY) is orb2911278.

What sizes are available for Recombinant Mannose permease IIC component (manY)?

Recombinant Mannose permease IIC component (manY) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Mannose permease IIC component (manY) come in?

Recombinant Mannose permease IIC component (manY) is available in 2 different pack sizes.

Is Recombinant Mannose permease IIC component (manY) in stock?

Recombinant Mannose permease IIC component (manY) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Mannose permease IIC component (manY)

This Recombinant Mannose permease IIC component (manY) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Mannose permease IIC component, EII-P-Man, EIIC-Man, PTS system mannose-specific EIIC component

UniProt

P69802

Expression Region

1-266

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEITTLQIVLVFIVACIAGMGSILDEFQFHRPLIACTLVGIVLGDMKTGIIIGGTLEMIA LGWMNIGAAVAPDAALASIISTILVIAGHQSIGAGIALAIPLAAAGQVLTIIVRTITVAF QHAADKAADNGNLTAISWIHVSSLFLQAMRVAIPAVIVALSVGTSEVQNMLNAIPEVVTN GLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNFNLVALGVIGTVMAVLYIQ LSPKYNRVAGAPAQAAGNNDLDNELD