Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus suis Undecaprenyl-diphosphatase (uppP)

This Recombinant Streptococcus suis Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A4VXK6

Expression Region

1-278

Origin

Streptococcus suis (strain 05ZYH33)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLELLKAIFLGIIEGVTEWLPVSSTGHLILVQEFVKLNQSKNFLEMFNIVIQLGAILAV MTIYFKKLNPFQPGKTKRDIQLTWQLWAKVVIACIPSILIAVPLDNWFEAHFNFMVPIAI ALIVYGIAFIWIENRNRGIEPQVTDLAKMSYKTALLIGCFQVLSIVPGTSRSGATILGAI ILGTSRSVAADFTFFLGIPTMFGYSGLKAVKYFLDGNSLNMEQVWILLVASVTAYLVSLV VIRFLTDFVKKHDFTVFGYYRIILGAILLVYAFITFLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PAN3 Antibody [Alexa Fluor 750]
NBP2-44286AF750 0.1 mL

Rabbit Polyclonal PAN3 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Anti-MTH1 Rabbit Monoclonal Antibody, Carrier-free
M04258-carrier-free 100 µL

Anti-MTH1 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Human Nuclear factor 1 C type (NFIC) ELISA Kit
GTR10312476 96 Well

Human Nuclear factor 1 C type (NFIC) ELISA Kit

Sign In for Pricing
View Details
ABCG4 Antibody
orb1259877 100 µL

ABCG4 Antibody

Sign In for Pricing
View Details
Recombinant Desulfovibrio desulfuricans Enolase (eno)
MBS1287423-01 0.02 mg (E-Coli)

Recombinant Desulfovibrio desulfuricans Enolase (eno)

Sign In for Pricing
View Details
Recombinant Desulfovibrio desulfuricans Enolase (eno)
MBS1287423-02 0.02 mg (Yeast)

Recombinant Desulfovibrio desulfuricans Enolase (eno)

Sign In for Pricing
View Details