Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus suis Undecaprenyl-diphosphatase (uppP)

This Recombinant Streptococcus suis Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A4VXK6

Expression Region

1-278

Origin

Streptococcus suis (strain 05ZYH33)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLELLKAIFLGIIEGVTEWLPVSSTGHLILVQEFVKLNQSKNFLEMFNIVIQLGAILAV MTIYFKKLNPFQPGKTKRDIQLTWQLWAKVVIACIPSILIAVPLDNWFEAHFNFMVPIAI ALIVYGIAFIWIENRNRGIEPQVTDLAKMSYKTALLIGCFQVLSIVPGTSRSGATILGAI ILGTSRSVAADFTFFLGIPTMFGYSGLKAVKYFLDGNSLNMEQVWILLVASVTAYLVSLV VIRFLTDFVKKHDFTVFGYYRIILGAILLVYAFITFLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC30A7 (NM_001144884) Human Recombinant Protein
E45H33290M5 20 µg

SLC30A7 (NM_001144884) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Clostridium Perfringens ssb Protein (aa 1-150)
VAng-Lsx00878-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Perfringens ssb Protein (aa 1-150)

Sign In for Pricing
View Details
ALK Antibody
orb534625-01 20 µg

ALK Antibody

Sign In for Pricing
View Details
ALK Antibody
orb534625-02 100 µg

ALK Antibody

Sign In for Pricing
View Details
ALK Antibody
orb534625-03 100 ug (without BSA and Azide)

ALK Antibody

Sign In for Pricing
View Details
Sheep Pigment Epithelium Derived Factor ELISA Kit
MBS737918-01 48 Well

Sheep Pigment Epithelium Derived Factor ELISA Kit

Sign In for Pricing
View Details