Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus suis Undecaprenyl-diphosphatase (uppP)

This Recombinant Streptococcus suis Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A4VXK6

Expression Region

1-278

Origin

Streptococcus suis (strain 05ZYH33)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLELLKAIFLGIIEGVTEWLPVSSTGHLILVQEFVKLNQSKNFLEMFNIVIQLGAILAV MTIYFKKLNPFQPGKTKRDIQLTWQLWAKVVIACIPSILIAVPLDNWFEAHFNFMVPIAI ALIVYGIAFIWIENRNRGIEPQVTDLAKMSYKTALLIGCFQVLSIVPGTSRSGATILGAI ILGTSRSVAADFTFFLGIPTMFGYSGLKAVKYFLDGNSLNMEQVWILLVASVTAYLVSLV VIRFLTDFVKKHDFTVFGYYRIILGAILLVYAFITFLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Thermoanaerobacter tengcongensis Polyribonucleotide nucleotidyltransferase (pnp), partial
MBS1471874 Inquire

Recombinant Thermoanaerobacter tengcongensis Polyribonucleotide nucleotidyltransferase (pnp), partial

Sign In for Pricing
View Details
Sytl3 Blocking peptide (Middle region)
AAP93867-100UG 100 µg

Sytl3 Blocking peptide (Middle region)

Sign In for Pricing
View Details
Cln8 3'UTR Lenti-reporter-Luc Vector
16363084 1.0 µg

Cln8 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SUC1 Antibody
orb750394 2 mL

SUC1 Antibody

Sign In for Pricing
View Details
TPRA1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV626061 1.0 µg DNA

TPRA1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Forkhead Box L1 (FOXL1) Antibody
abx212375-01 50 µL

Forkhead Box L1 (FOXL1) Antibody

Sign In for Pricing
View Details