Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanosarcina acetivorans Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Methanosarcina acetivorans Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

Q8TTZ9

Expression Region

1-304

Origin

Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPLIGMGVLALIGVAATIAGASEDLESDVGSQSNPNSQVQLAPQMMFPHRIFNKAVSGE PPSNALMCSVGAAVATVLISEFTLSPLFALVLGALIAACVHGTFAVTSTMGRAASQSRFK QPVYLDMIRSHTPVIMGYSFITTFCILVVSYLMTVVLGHPFPLTMLAFIWGITVGAIGSS TGDVHYGAEREFQQFEFGSGLNASNSGNIVRYGESGVRNGYDNSWFCAKFGGPVTGMAFG MTVFLGSWVTTVFDPAVSISRGWISVVAGVIIVLILIFWNWKIEVKARNAYGPYKEDKTE EASA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-100 1x 100 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
BNC470050-500 1x 500 µL

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
BNC470225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-500 1x 500 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details