Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Putative peptide transport system permease protein BMEII0209 (BMEII0209)

This Recombinant Brucella melitensis biotype 1 Putative peptide transport system permease protein BMEII0209 (BMEII0209) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Putative peptide transport system permease protein BMEII0209

UniProt

Q8YDG7

Expression Region

1-315

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMTALILKRVAQAIPVMLIVAILTFLLMKLLPGDPAILIAGDGASPETVERIRVELGLDQ PTVVQLGQWLWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVV AAYLRDSWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLGWFPSAGYVPFLDSPLGWLR SLILPASILALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSV LTVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQAILARDLPVVQGTMLFLGFLFVAINVL VDILYTIADPRVRYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody
MBS2563806-01 0.1 mL

Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody
MBS2563806-02 0.2 mL

Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody
MBS2563806-03 5x 0.2 mL

Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody

Sign In for Pricing
View Details
ART2B siRNA (Rat)
MBS8239021-01 15 nmol

ART2B siRNA (Rat)

Sign In for Pricing
View Details
ART2B siRNA (Rat)
MBS8239021-02 30 nmol

ART2B siRNA (Rat)

Sign In for Pricing
View Details
ART2B siRNA (Rat)
MBS8239021-03 5x 30 nmol

ART2B siRNA (Rat)

Sign In for Pricing
View Details