Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Probable envelope ADP, ATP carrier protein, chloroplastic (EAAC)

This Recombinant Arabidopsis thaliana Probable envelope ADP, ATP carrier protein, chloroplastic (EAAC) spans the amino acid sequence from region 27-381.

Product Specifications

Product Name Alternative

Probable envelope ADP, ATP carrier protein, chloroplastic, Envelope ADP/ATP translocase

UniProt

O65023

Expression Region

27-381

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AKSGAEQFRRRVLRNPARGDFGLGRFACISLVEKCEQREFAPTTAQLLNNPLAILALVPK DAAIFAAGALAGAAAKTVTAPLDRIKLLMQTHGIRLGQQSAKKAIGFIEAITLIAKEEGV KGYWKGNLPQVIRVLPYSAVQLLAYESYKNLFKGKDDQLSVIGRLAAGACAGMTSTLLTY PLDVLRLRLAVEPGYRTMSQVALSMLRDEGIASFYYGLGPSLVGIAPYIAVNFCIFDLVK KSLPEEYRKKAQSSLLTAVLSAGIATLTCYPLDTVRRQMQMRGTPYKSIPEAFAGIIDRD GLIGLYRGFLPNALKTLPNSSIRLTTFDMVKRLIATSEKQLQKISDDNRNRDQAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-100 1x 100 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-500 1x 500 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (HPCA1/1171), CF405S conjugate, 0.1mg/mL
BNC041171-100 1x 100 µL

CD34 (HPCA1/1171), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF640R conjugate, 0.1mg/mL
BNC402993-500 1x 500 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF647 conjugate, 0.1mg/mL
BNC472897-100 1x 100 µL

Major Vault Protein (MVP) (VP2897R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details