Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Sensor protein lytS (lytS)

This Recombinant Staphylococcus haemolyticus Sensor protein lytS (lytS) spans the amino acid sequence from region 1-584.

Product Specifications

Product Name Alternative

Sensor protein lytS, EC= 2.7.13.3, Autolysin sensor kinase

UniProt

Q4L8V3

Expression Region

1-584

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNLFILLLERVGLIIIIAYMLMNINHFKTMMGEREKLRSQWQLTILFALFAITSNFTGI EIENGHIVSSNIYYQLNDDASMANTRVLTIGMSGLIGGPFVAIIVGIVSGLSRLYIGGAN AYTYLISSIFIALISGFYGYRTMRRYTYPTVLMGAIIGALNEAIQMACILIFANDTASAW SLVQFIALPMILINSIGTAIFLSIILSTLKQEEQTRAIQTHDVFEIANKTLPYFRSGLTE QSARSVAEIILKLMNVSAVAITNRTDILTHVGAASDHHVAKKAIITDLSKEVIKTGHLKE AHSKEEIGCNNPNCSLTSAIVIPLMINQEVAGTLKFYFTNEYENTTSTKQLARGLADIFS SQLELGQAEMQSKLLKDAEIKSLQAQVNPHFFFNSINTISALVRIDSEKARKLLLQLSQF FRSNLQGARNNTITLGKELQQVEAYLALEQARFPDRFTIQYHIDSSCKHVLIPPFVIQIL VENAIKHAFKHRRKDNIIDVVAHHDNEELTLTVRDNGSGIDDDKLPLIGQMSVDSETGTG SALENLNRRLIGLYGTKAALHFESTEIGTTVSCHIPSHTIKEDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Connexin 30.3 (CX30.3, Gap Junction Beta 5 Protein, CXB5) (FITC)
MBS6470060-01 0.1 mL

Connexin 30.3 (CX30.3, Gap Junction Beta 5 Protein, CXB5) (FITC)

Sign In for Pricing
View Details
Connexin 30.3 (CX30.3, Gap Junction Beta 5 Protein, CXB5) (FITC)
MBS6470060-02 5x 0.1 mL

Connexin 30.3 (CX30.3, Gap Junction Beta 5 Protein, CXB5) (FITC)

Sign In for Pricing
View Details
Monoclonal antibody to RLIP (Clone: ABM1C8.1D9)
10-1068-25 25 µg

Monoclonal antibody to RLIP (Clone: ABM1C8.1D9)

Sign In for Pricing
View Details
CXCL12 (SDF-1-alpha, Stromal Cell-derived Factor 1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-stimulating Factor, PBSF, SDF1, SDF1A) (Biotin)
MBS6141421-01 0.1 mL

CXCL12 (SDF-1-alpha, Stromal Cell-derived Factor 1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-stimulating Factor, PBSF, SDF1, SDF1A) (Biotin)

Sign In for Pricing
View Details
CXCL12 (SDF-1-alpha, Stromal Cell-derived Factor 1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-stimulating Factor, PBSF, SDF1, SDF1A) (Biotin)
MBS6141421-02 5x 0.1 mL

CXCL12 (SDF-1-alpha, Stromal Cell-derived Factor 1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-stimulating Factor, PBSF, SDF1, SDF1A) (Biotin)

Sign In for Pricing
View Details
Guinea pig Pro-Nerve Growth Factor 1 ELISA Kit
MBS754274-01 48 Well

Guinea pig Pro-Nerve Growth Factor 1 ELISA Kit

Sign In for Pricing
View Details