Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium sp. Bacteriorhodopsin (bop)

This Recombinant Halobacterium sp. Bacteriorhodopsin (bop) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

Bacteriorhodopsin, BR

UniProt

O93740

Expression Region

1-250

Origin

Halobacterium sp. (strain arg-4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCCAALAPPMAATVGPESIWLWIGTIGMTLGTLYFVGRGRGVRDRKMQEFYIITIFITTI AAAMYFAMATGFGVTEVMVGDEALTIYWARYADWLFTTPLLLLDLSLLAGANRNTIATLI GLDVFMIGTGAIAALSSTPGTRIAWWAISTGALLALLYVLVGTLSENARNRAPEVASLFG RLRNLVIALWFLYPVVWILGTEGTFGILPLYWETAAFMVLDLSAKVGFGVILLQSRSVLE RVATPTAAPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BGLAP Polyclonal Antibody
E-AB-40103-01 20 µL

BGLAP Polyclonal Antibody

Sign In for Pricing
View Details
BGLAP Polyclonal Antibody
E-AB-40103-02 60 µL

BGLAP Polyclonal Antibody

Sign In for Pricing
View Details
BGLAP Polyclonal Antibody
E-AB-40103-03 120 µL

BGLAP Polyclonal Antibody

Sign In for Pricing
View Details
BGLAP Polyclonal Antibody
E-AB-40103-04 200 µL

BGLAP Polyclonal Antibody

Sign In for Pricing
View Details
KLK2 Conjugated Antibody
MBS9448714-01 0.1 mL (Biotin)

KLK2 Conjugated Antibody

Sign In for Pricing
View Details
KLK2 Conjugated Antibody
MBS9448714-02 0.1 mL (AF350)

KLK2 Conjugated Antibody

Sign In for Pricing
View Details