Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 4B13 (Or4b13)

This Recombinant Mouse Olfactory receptor 4B13 (Or4b13) ) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Olfactory receptor 142, Olfactory receptor 227-2, Olfactory receptor 4C

UniProt

Q60881

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANKNNVTELIFTGLFQDPEVQKVCFVLFLPVYLATLLGNSLILVAVSISKTLHSPMYFF LSSLSLVEICYSSTIVPKFITDLLAKVKTISLKGCLTQIFFSHFFGVVEVILLVVMAYDR YVAICKPLHYMNIMSRQVCHMLVAGSWLGGFIHSIIQIIITIPLPFCGPNVIDHYFCDLQ QLFKLACTDTFMEGFIVMANSGLISIVSLFILVSSYAVILISLRKRSAEGRRKALSTCAS HITVVILFFVPGAFIYMRPSSTFTEDKLVSVFYTVITPMLNPIVYTLRNTEMKNAIRMSW KQKDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jagged1 Polyclonal Antibody
bs-1448R 100 µL

Jagged1 Polyclonal Antibody

Sign In for Pricing
View Details
EIF2A cDNA Clone
MBS1272276-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

EIF2A cDNA Clone

Sign In for Pricing
View Details
EIF2A cDNA Clone
MBS1272276-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

EIF2A cDNA Clone

Sign In for Pricing
View Details
Olfr164 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4233102 1.0 µg DNA

Olfr164 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Polyclonal Antibody to Wingless Type MMTV Integration Site Family, Member 2 (WNT2)
TRV-0046755-01 20 µL

Polyclonal Antibody to Wingless Type MMTV Integration Site Family, Member 2 (WNT2)

Sign In for Pricing
View Details
Polyclonal Antibody to Wingless Type MMTV Integration Site Family, Member 2 (WNT2)
TRV-0046755-02 100 µL

Polyclonal Antibody to Wingless Type MMTV Integration Site Family, Member 2 (WNT2)

Sign In for Pricing
View Details