Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 4B13 (Or4b13)

This Recombinant Mouse Olfactory receptor 4B13 (Or4b13) ) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Olfactory receptor 142, Olfactory receptor 227-2, Olfactory receptor 4C

UniProt

Q60881

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANKNNVTELIFTGLFQDPEVQKVCFVLFLPVYLATLLGNSLILVAVSISKTLHSPMYFF LSSLSLVEICYSSTIVPKFITDLLAKVKTISLKGCLTQIFFSHFFGVVEVILLVVMAYDR YVAICKPLHYMNIMSRQVCHMLVAGSWLGGFIHSIIQIIITIPLPFCGPNVIDHYFCDLQ QLFKLACTDTFMEGFIVMANSGLISIVSLFILVSSYAVILISLRKRSAEGRRKALSTCAS HITVVILFFVPGAFIYMRPSSTFTEDKLVSVFYTVITPMLNPIVYTLRNTEMKNAIRMSW KQKDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
14050061 1.0 µg DNA

C19orf18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
S-(-)-Nicotine-D1'-(5')-iminium Diperchlorate Salt (S-(-)-Nicotine-immonium Ion Diperchlorate Salt)
MBS6082628-01 10 mg

S-(-)-Nicotine-D1'-(5')-iminium Diperchlorate Salt (S-(-)-Nicotine-immonium Ion Diperchlorate Salt)

Sign In for Pricing
View Details
S-(-)-Nicotine-D1'-(5')-iminium Diperchlorate Salt (S-(-)-Nicotine-immonium Ion Diperchlorate Salt)
MBS6082628-02 5x 10 mg

S-(-)-Nicotine-D1'-(5')-iminium Diperchlorate Salt (S-(-)-Nicotine-immonium Ion Diperchlorate Salt)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Branchpoint-bridging protein (BBP), partial
MBS1205828 Inquire

Recombinant Cryptococcus neoformans var. neoformans serotype D Branchpoint-bridging protein (BBP), partial

Sign In for Pricing
View Details
LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (Biotin)
MBS6142741-01 0.1 mL

LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (Biotin)

Sign In for Pricing
View Details
LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (Biotin)
MBS6142741-02 5x 0.1 mL

LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (Biotin)

Sign In for Pricing
View Details