Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 4B13 (Or4b13)

This Recombinant Mouse Olfactory receptor 4B13 (Or4b13) ) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Olfactory receptor 142, Olfactory receptor 227-2, Olfactory receptor 4C

UniProt

Q60881

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANKNNVTELIFTGLFQDPEVQKVCFVLFLPVYLATLLGNSLILVAVSISKTLHSPMYFF LSSLSLVEICYSSTIVPKFITDLLAKVKTISLKGCLTQIFFSHFFGVVEVILLVVMAYDR YVAICKPLHYMNIMSRQVCHMLVAGSWLGGFIHSIIQIIITIPLPFCGPNVIDHYFCDLQ QLFKLACTDTFMEGFIVMANSGLISIVSLFILVSSYAVILISLRKRSAEGRRKALSTCAS HITVVILFFVPGAFIYMRPSSTFTEDKLVSVFYTVITPMLNPIVYTLRNTEMKNAIRMSW KQKDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS18C (NM_016067) Human Untagged Clone
SC320819 10 µg

MRPS18C (NM_016067) Human Untagged Clone

Sign In for Pricing
View Details
Lentiviral mouse Nfkbie shRNA (UAS) - Lentiviral mouse Nfkbie shRNA (UAS) plasmid
GTR15195907 1 Vial

Lentiviral mouse Nfkbie shRNA (UAS) - Lentiviral mouse Nfkbie shRNA (UAS) plasmid

Sign In for Pricing
View Details
pUNO1-hTNFSF15a
puno1-htnfsf15 20 µg

pUNO1-hTNFSF15a

Sign In for Pricing
View Details
Mouse Alpha-defensin-related sequence 2, Defa-rs2 ELISA KIT
ELI-26327m 96 Tests

Mouse Alpha-defensin-related sequence 2, Defa-rs2 ELISA KIT

Sign In for Pricing
View Details
LRP4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
27610111 3x 1.0 µg

LRP4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Anti-Ferritin Light Chain Mouse mAb
MBS475160-01 0.1 mL

Anti-Ferritin Light Chain Mouse mAb

Sign In for Pricing
View Details