Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8J1 (OR8J1)

This Recombinant Human Olfactory receptor 8J1 (OR8J1) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 8J1, Olfactory receptor OR11-183

UniProt

Q8NGP2

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPENFTRVTEFILTGVSSCPELQIPLFLVFLVLYGLTMAGNLGIITLTSVDSRLQTPMY FFLQHLALINLGNSTVIAPKMLINFLVKKKTTSFYECATQLGGFLFFIVSEVIMLALMAY DRYVAICNPLLYMVVVSRRLCLLLVSLTYLYGFSTAIVVSSYVFSVSYCSSNIINHFYCD NVPLLALSCSDTYLPETVVFISAATNVVGSLIIVLVSYFNIVLSILKICSSEGRKKAFST CASHMMAVTIFYGTLLFMYVQPRSNHSLDTDDKMASVFYTLVIPMLNPLIYSLRNKDVKT ALQRFMTNLCYSFKTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brd3 (NM_001108575) Rat Tagged Lenti ORF Clone
RR204633L4 10 µg

Brd3 (NM_001108575) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
XRRA1 Peptide - N-terminal region (AAP53441)
AAP53441-100UG 100 µg

XRRA1 Peptide - N-terminal region (AAP53441)

Sign In for Pricing
View Details
RAP2B, member of RAS oncogene family
331990 100 µL

RAP2B, member of RAS oncogene family

Sign In for Pricing
View Details
LEMD3 antibody
10R-4613 100 ul

LEMD3 antibody

Sign In for Pricing
View Details
Human VWF Antibody , APC
E55A08085 50 Tests

Human VWF Antibody , APC

Sign In for Pricing
View Details
5-HT4 antagonist 1
BUP08174-01 5 mg

5-HT4 antagonist 1

Sign In for Pricing
View Details