Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5B21 (OR5B21)

This Recombinant Human Olfactory receptor 5B21 (OR5B21) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 5B21

UniProt

A6NL26

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENSTEVTEFILLGLTDDPNLQIPLLLAFLFIYLITLLGNGGMMVIIHSDSHLHTPMYFF LSNLSLVDLGYSSAVAPKTVAALRSGDKAISYDGCAAQFFFFVGFATVECYLLASMAYDR HAAVCRPLHYTTTMTAGVCALLATGSYVSGFLNASIHAAGTFRLSFCGSNEINHFFCDIP PLLALSCSDTRISKLVVFVAGFNVFFTLLVILISYFFICITIQRMHSAEGQKKVFSTCAS HLTALSIFYGTIIFMYLQPNSSQSVDTDKIASVFYTVVIPMLNPLIYSLRNKEVKSALWK ILNKLYPQY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEC (N-term) Rabbit Polyclonal Antibody
AP54214PU-N 400 µL

TEC (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ezrin (EZR) pThr566 Rabbit Polyclonal Antibody
AP02470PU-N 100 µL

Ezrin (EZR) pThr566 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TBP Antibody
8C10435-AAT 50 µg

TBP Antibody

Sign In for Pricing
View Details
IL2 Receptor alpha (IL2RA) Mouse Monoclonal Antibody [Clone ID: OTI2C7]
TA813471 100 µL

IL2 Receptor alpha (IL2RA) Mouse Monoclonal Antibody [Clone ID: OTI2C7]

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF640R conjugate, 0.1mg/mL
BNC401628-100 1x 100 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PMS2 Rabbit Polyclonal Antibody
TA380088 100 µL

PMS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details