Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5B21 (OR5B21)

This Recombinant Human Olfactory receptor 5B21 (OR5B21) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 5B21

UniProt

A6NL26

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENSTEVTEFILLGLTDDPNLQIPLLLAFLFIYLITLLGNGGMMVIIHSDSHLHTPMYFF LSNLSLVDLGYSSAVAPKTVAALRSGDKAISYDGCAAQFFFFVGFATVECYLLASMAYDR HAAVCRPLHYTTTMTAGVCALLATGSYVSGFLNASIHAAGTFRLSFCGSNEINHFFCDIP PLLALSCSDTRISKLVVFVAGFNVFFTLLVILISYFFICITIQRMHSAEGQKKVFSTCAS HLTALSIFYGTIIFMYLQPNSSQSVDTDKIASVFYTVVIPMLNPLIYSLRNKEVKSALWK ILNKLYPQY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C6orf138 (PTCHD4) activation kit by CRISPRa
GA118543 1 Kit

Human C6orf138 (PTCHD4) activation kit by CRISPRa

Sign In for Pricing
View Details
STAT1 (Ab-727) Antibody
8B7221-AAT 50 µg

STAT1 (Ab-727) Antibody

Sign In for Pricing
View Details
N6-Lauroyl Cordycepin
TRC-L185500-2MG 2 mg

N6-Lauroyl Cordycepin

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS519552 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
Adcy3 Mouse Gene Knockout Kit (CRISPR)
KN500889 1 Kit

Adcy3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SOX10 (SOX10/991 + SOX10/1074), CF568 conjugate, 0.1mg/mL
BNC681074-500 1x 500 µL

SOX10 (SOX10/991 + SOX10/1074), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details