Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 5 (Taar5)

This Recombinant Mouse Trace amine-associated receptor 5 (Taar5) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 5, TaR-5, Trace amine receptor 5

UniProt

Q5QD14

Expression Region

1-337

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVS YFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLT SIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALS QWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSL AGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSAC NPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (TFRC/1149), CF647 conjugate, 0.1mg/mL
BNC471149-100 1x 100 µL

CD71 (TFRC/1149), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCHE Polyclonal Antibody
E-AB-18553-01 20 µL

BCHE Polyclonal Antibody

Sign In for Pricing
View Details
BCHE Polyclonal Antibody
E-AB-18553-02 60 µL

BCHE Polyclonal Antibody

Sign In for Pricing
View Details
BCHE Polyclonal Antibody
E-AB-18553-03 120 µL

BCHE Polyclonal Antibody

Sign In for Pricing
View Details
BCHE Polyclonal Antibody
E-AB-18553-04 200 µL

BCHE Polyclonal Antibody

Sign In for Pricing
View Details
CYB5R3 Recombinant Rabbit Monoclonal Antibody [JE63-51]
HA721008 100 µL

CYB5R3 Recombinant Rabbit Monoclonal Antibody [JE63-51]

Sign In for Pricing
View Details