Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 5 (Taar5)

This Recombinant Mouse Trace amine-associated receptor 5 (Taar5) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 5, TaR-5, Trace amine receptor 5

UniProt

Q5QD14

Expression Region

1-337

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVS YFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLT SIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALS QWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSL AGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSAC NPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KCT2 (C5orf15) activation kit by CRISPRa
GA111297 1 Kit

Human KCT2 (C5orf15) activation kit by CRISPRa

Sign In for Pricing
View Details
Diethyl Butylethylmalonate-d5
TRC-D443877-10MG 10 mg

Diethyl Butylethylmalonate-d5

Sign In for Pricing
View Details
ARHGAP25 (NM_001166277) Human Over-expression Lysate
LC431525 20 µg

ARHGAP25 (NM_001166277) Human Over-expression Lysate

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2424), CF594 conjugate, 0.1mg/mL
BNC942424-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2424), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Skin
CS636509 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details
Tissue FFPE Sections, Small intestine
CS801841 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details