Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesorhizobium sp. ATP synthase subunit a (atpB)

This Recombinant Mesorhizobium sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q11KH9

Expression Region

1-249

Origin

Mesorhizobium sp. (strain BNC1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDPIHQFQISKLIPIEIGGLDFSFTNSSLFMVATVAAAGAFLYLTTSSRGLVPSRMQS VSEMSYEFVASMLRDAAGSHGMRFFPFVFSLFMFVLVANLLGLFPYFFTVTSHIVVTFAL ALLVIGTVLVYGFWKHGFGFLKLFVPEGVPGVLLPLVVLIEVISFLSRPISLSVRLFANM LAGHITLKVFAGFVTSLGALGVAGAAGAVLPLAMTVALTGLELLVAFLQAYVFAVLTCMY LNDALHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-500 1x 500 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-100 1x 100 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/1190), CF647 conjugate, 0.1mg/mL
BNC471190-100 1x 100 µL

Cytokeratin 18 (KRT18/1190), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF640R conjugate, 0.1mg/mL
BNC402217-500 1x 500 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF740 conjugate, 0.1mg/mL
BNC741798-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details