Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken P2Y purinoceptor 1 (P2RY1)

This Recombinant Chicken P2Y purinoceptor 1 (P2RY1) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

P2Y purinoceptor 1, P2Y1, ATP receptor, Purinergic receptor

UniProt

P34996

Expression Region

1-362

Origin

Gallus gallus (Chicken)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEALISAALNGTQPELLAGGWAAGNATTKCSLTKTGFQFYYLPTVYILVFITGFLGNSV AIWMFVFHMRPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDVMCKLQRFIF HVNLYGSILFLTCISVHRYTGVVHPLKSLGRLKKKNAVYVSSLVWALVVAVIAPILFYSG TGVRRNKTITCYDTTADEYLRSYFVYSMCTTVFMFCIPFIVILGCYGLIVKALIYKDLDN SPLRRKSIYLVIIVLTVFAVSYLPFHVMKTLNLRARLDFQTPQMCAFNDKVYATYQVTRG LASLNSCVDPILYFLAGDTFRRRLSRATRKSSRRSEPNVQSKSEEMTLNILTEYKQNGDT SL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-100 1x 100 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-500 1x 500 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF640R conjugate, 0.1mg/mL
BNC402685-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DRA) (19-26.1), CF647 conjugate, 0.1mg/mL
BNC471082-500 1x 500 µL

MHC II (HLA-DRA) (19-26.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details