Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig G-protein coupled receptor 4 (GPR4)

This Recombinant Pig G-protein coupled receptor 4 (GPR4) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

G-protein coupled receptor 4, G-protein coupled receptor 19

UniProt

P50132

Expression Region

1-362

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNGTWEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLRLWAAYRQVRQRNELGVYLMNLS IADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVA HPLRFARLRRVKTAVAVSSVVWATELGANSVPLFHDELFRDRYNHTFCFEKFPMEGWVAW MNLYRVFVGFLFPWALMLLSYRGILRAVRGSVSTERQEKAKIKRLALSLIAIVLVCFAPY HVLLLSRSAVYLGHPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVAKA LHNLLRFLTSDKPQEMASASLTLDTPLTSKRNSMARAVAAAGWHLRPPRDQVQLKMLPPP AP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse EphA3 Protein (aa 569-984, His & GST Tag)
PKSM040288 50 µg

Recombinant Mouse EphA3 Protein (aa 569-984, His & GST Tag)

Sign In for Pricing
View Details
Drebrin 1 (DBN1) (DBN1/2879), CF405S conjugate, 0.1mg/mL
BNC042879-500 1x 500 µL

Drebrin 1 (DBN1) (DBN1/2879), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RHNO1 activation kit by CRISPRa
GA113237 1 Kit

Human RHNO1 activation kit by CRISPRa

Sign In for Pricing
View Details
IFNA5 (NM_002169) Human Over-expression Lysate
LY419486 100 µg

IFNA5 (NM_002169) Human Over-expression Lysate

Sign In for Pricing
View Details
Plastin L (LCP1) Human Gene Knockout Kit (CRISPR)
KN401670 1 Kit

Plastin L (LCP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse IgG2b (Fcγ Fragment specific), AlpHcAbs® Goat antibody
HA710135 100 µg

Mouse IgG2b (Fcγ Fragment specific), AlpHcAbs® Goat antibody

Sign In for Pricing
View Details