Recombinant Human Melatonin receptor type 1B (MTNR1B)
This Recombinant Human Melatonin receptor type 1B (MTNR1B) spans the amino acid sequence from region 1-362.
Product Specifications
Product Name Alternative
Melatonin receptor type 1B, Mel-1B-R, Mel1b receptor
UniProt
P49286
Expression Region
1-362
Origin
Homo sapiens (Human)
Field of Research
Pharmacology & Drug Discovery
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD AL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6481529-01 0.2 mL
ILK (S246) (Integrin-linked Protein Kinase, ILK-1, ILK-2, 59kD Serine/Threonine-protein Kinase, p59ILK, ILK1, ILK2) (Biotin)
Sign In for Pricing
View Details MBS6481529-02 5x 0.2 mL
ILK (S246) (Integrin-linked Protein Kinase, ILK-1, ILK-2, 59kD Serine/Threonine-protein Kinase, p59ILK, ILK1, ILK2) (Biotin)
Sign In for Pricing
View Details MBS6311276-01 0.1 mL
ITGB1BP3, ID (NMRK2, ITGB1BP3, NRK2, Nicotinamide riboside kinase 2, Integrin beta-1-binding protein 3, Muscle integrin-binding protein, Nicotinic acid riboside kinase 2, Ribosylnicotinamide kinase 2, Ribosylnicotinic acid kinase 2) (MaxLight 650)
Sign In for Pricing
View Details MBS6311276-02 5x 0.1 mL
ITGB1BP3, ID (NMRK2, ITGB1BP3, NRK2, Nicotinamide riboside kinase 2, Integrin beta-1-binding protein 3, Muscle integrin-binding protein, Nicotinic acid riboside kinase 2, Ribosylnicotinamide kinase 2, Ribosylnicotinic acid kinase 2) (MaxLight 650)
Sign In for Pricing
View Details