Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Melatonin receptor type 1B (MTNR1B)

This Recombinant Human Melatonin receptor type 1B (MTNR1B) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

Melatonin receptor type 1B, Mel-1B-R, Mel1b receptor

UniProt

P49286

Expression Region

1-362

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD AL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TET1 Antibody [PE]
NBP2-97605PE 0.1 mL

Rabbit Polyclonal TET1 Antibody [PE]

Sign In for Pricing
View Details
CCDC92 Protein Vector (Mouse) (pPB-C-His)
PV162666 500 ng

CCDC92 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
SPPase1 Rabbit pAb
E47R17659 100 µL

SPPase1 Rabbit pAb

Sign In for Pricing
View Details
ZNF404 Antibody; FITC conjugated
MBS7001086-01 0.05 mg

ZNF404 Antibody; FITC conjugated

Sign In for Pricing
View Details
ZNF404 Antibody; FITC conjugated
MBS7001086-02 0.1 mg

ZNF404 Antibody; FITC conjugated

Sign In for Pricing
View Details
ZNF404 Antibody; FITC conjugated
MBS7001086-03 5x 0.1 mg

ZNF404 Antibody; FITC conjugated

Sign In for Pricing
View Details