Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-X-C chemokine receptor type 7 (Cxcr7)

This Recombinant Mouse C-X-C chemokine receptor type 7 (Cxcr7) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

C-X-C chemokine receptor type 7, CXC-R7, CXCR-7, Chemokine orphan receptor 1, G-protein coupled receptor RDC1 homolog, RDC-1

UniProt

P56485

Expression Region

1-362

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVHLFDYAEPGNYSDINWPCNSSDCIVVDTVQCPTMPNKNVLLYTLSFIYIFIFVIGMI ANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVITIPVWVVSLVQHNQWPMGELTCKIT HLIFSINLFGSIFFLACMSVDRYLSITYFTGTSSYKKKMVRRVVCILVWLLAFFVSLPDT YYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVILGFAVPFTIIAIFYFLLARAMS ASGDQEKHSSRKIIFSYVVVFLVCWLPYHFVVLLDIFSILHYIPFTCQLENVLFTALHVT QCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQN TK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-100 1x 100 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-100 1x 100 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF488A conjugate, 0.1mg/mL
BNC882563-500 1x 500 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/261), CF594 conjugate, 0.1mg/mL
BNC940261-500 1x 500 µL

CD66 (CEA) (C66/261), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details