Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-17 (srb-17)

This Recombinant Serpentine receptor class beta-17 (srb-17) spans the amino acid sequence from region 1-363.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-17, Protein srb-17

UniProt

O02241

Expression Region

1-363

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKTKLASSVELSFEEPELFVHMYDFAVEITDEFCQIAFPGAFHPAFLLVKLYHILLSVI SMGSIIYFFLNYSNLLAFHFNIKILFFFQFCSCFLQSATLAISQTHHLVLALIANGPCDV ILAPALFALFNLPLIFSMLCMEFSQVLMVIERTLASCLFVCYEKTTKTIGFVLTSFAVIV PGLTCLYMYYDDKFNYPQMSAMATSPSSKLRINYIFITINVLNVLTLMHSIGLYRHNKQK INMVKGRDHFILSSRFQMNENVSSSKLLWRLSCAQLIIFLLYGCAMYSLRIFLPGERSAV WQAVTEFCYTPPLYCAIMPLICIVCAQNSLKQRNSKVQSLITLRSVGQEGWDNYQGMLQK QWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 (V92.1), CF740 conjugate, 0.1mg/mL
BNC740680-100 1x 100 µL

Cyclin B1 (V92.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TTC8 activation kit by CRISPRa
GA114796 1 Kit

Human TTC8 activation kit by CRISPRa

Sign In for Pricing
View Details
PIN4 (NM_006223) Human Over-expression Lysate
LY401874 100 µg

PIN4 (NM_006223) Human Over-expression Lysate

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF568 conjugate, 0.1mg/mL
BNC681563-500 1x 500 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNMT3A (NM_022552) Human Recombinant Protein
TP313064 20 µg

DNMT3A (NM_022552) Human Recombinant Protein

Sign In for Pricing
View Details
p47-phox Mouse Monoclonal Antibody [A6B10]
HA600050 100 µL

p47-phox Mouse Monoclonal Antibody [A6B10]

Sign In for Pricing
View Details