Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-17 (srb-17)

This Recombinant Serpentine receptor class beta-17 (srb-17) spans the amino acid sequence from region 1-363.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-17, Protein srb-17

UniProt

O02241

Expression Region

1-363

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKTKLASSVELSFEEPELFVHMYDFAVEITDEFCQIAFPGAFHPAFLLVKLYHILLSVI SMGSIIYFFLNYSNLLAFHFNIKILFFFQFCSCFLQSATLAISQTHHLVLALIANGPCDV ILAPALFALFNLPLIFSMLCMEFSQVLMVIERTLASCLFVCYEKTTKTIGFVLTSFAVIV PGLTCLYMYYDDKFNYPQMSAMATSPSSKLRINYIFITINVLNVLTLMHSIGLYRHNKQK INMVKGRDHFILSSRFQMNENVSSSKLLWRLSCAQLIIFLLYGCAMYSLRIFLPGERSAV WQAVTEFCYTPPLYCAIMPLICIVCAQNSLKQRNSKVQSLITLRSVGQEGWDNYQGMLQK QWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (DF-T1), CF405S conjugate, 0.1mg/mL
BNC040027-100 1x 100 µL

CD43 (DF-T1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STARD4 Polyclonal Antibody
E-AB-66635-01 60 µL

STARD4 Polyclonal Antibody

Sign In for Pricing
View Details
STARD4 Polyclonal Antibody
E-AB-66635-02 120 µL

STARD4 Polyclonal Antibody

Sign In for Pricing
View Details
STARD4 Polyclonal Antibody
E-AB-66635-03 200 µL

STARD4 Polyclonal Antibody

Sign In for Pricing
View Details
PEA15 (NM_003768) Human Over-expression Lysate
LY401240 100 µg

PEA15 (NM_003768) Human Over-expression Lysate

Sign In for Pricing
View Details
P27 / KIP1 (DCS-72.F6 + KIP1/769 (SX53G8) ), CF405S conjugate, 0.1mg/mL
BNC041237-100 1x 100 µL

P27 / KIP1 (DCS-72.F6 + KIP1/769 (SX53G8) ), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details