Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 6 (Gpr6)

This Recombinant Mouse G-protein coupled receptor 6 (Gpr6) spans the amino acid sequence from region 1-363.

Product Specifications

Product Name Alternative

G-protein coupled receptor 6, Sphingosine 1-phosphate receptor GPR6

UniProt

Q6YNI2

Expression Region

1-363

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNASAAALNESQVVAVAAEGAAAAATAAGAPDTGEWGPPAASAALGGGGGPNGSLELSSQ LPAGPSGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADL LAGCGLILHFVFQYVVPSETVSLLMVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSR RTLLGVHLLLAATWTVSLGLGLLPVLGWNCLADRTSCSVVRPLTRSHVALLSTSFFVVFG IMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYC VVGSQEDPAIYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLFCGCFQSKVPFRSRSP SEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3alpha (Phospho-Ser21) Colorimetric Cell-Based ELISA Kit
EKC2420 1 Kit, Containing two 96 Well Plates and all necessary reagents

GSK3alpha (Phospho-Ser21) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Ptgdr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6688805 3x 1.0 µg

Ptgdr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
A4GNT Antibody - N-terminal region : HRP (ARP47220_P050-HRP)
ARP47220_P050-HRP 100 µL

A4GNT Antibody - N-terminal region : HRP (ARP47220_P050-HRP)

Sign In for Pricing
View Details
Haemophilus parasuis RT PCR kit
RTq-V118-50D 50T

Haemophilus parasuis RT PCR kit

Sign In for Pricing
View Details
Rabbit Polyclonal SGEF Antibody [Allophycocyanin]
NBP3-05912APC 0.1 mL

Rabbit Polyclonal SGEF Antibody [Allophycocyanin]

Sign In for Pricing
View Details
PNO1 CRISPRa sgRNA lentivector (set of three targets)(Human)
37111121 3x 1.0µg DNA

PNO1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details