Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 6 (Gpr6)

This Recombinant Mouse G-protein coupled receptor 6 (Gpr6) spans the amino acid sequence from region 1-363.

Product Specifications

Product Name Alternative

G-protein coupled receptor 6, Sphingosine 1-phosphate receptor GPR6

UniProt

Q6YNI2

Expression Region

1-363

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNASAAALNESQVVAVAAEGAAAAATAAGAPDTGEWGPPAASAALGGGGGPNGSLELSSQ LPAGPSGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADL LAGCGLILHFVFQYVVPSETVSLLMVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSR RTLLGVHLLLAATWTVSLGLGLLPVLGWNCLADRTSCSVVRPLTRSHVALLSTSFFVVFG IMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYC VVGSQEDPAIYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLFCGCFQSKVPFRSRSP SEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (1,3-Benzodioxol-5-yl) -1H-imidazole
sc-261233 1 g

4- (1,3-Benzodioxol-5-yl) -1H-imidazole

Sign In for Pricing
View Details
Glra1 3'UTR Lenti-reporter-Luc Vector
21616084 1.0 µg

Glra1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MAGI1 (C-term) Rabbit Polyclonal Antibody
AP15188PU-N 400 µL

MAGI1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Reusable Goniometer Base B5 (100 ea)
JBS-GB-B5-R-100 100 Each

Reusable Goniometer Base B5 (100 ea)

Sign In for Pricing
View Details
Desmin Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-1026R-BF555-TR 20 µL

Desmin Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Nek8 shRNA (h) Lentiviral Particles
sc-61176-V 200 µL

Nek8 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details