Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 78 (GPR78)

This Recombinant Human G-protein coupled receptor 78 (GPR78) spans the amino acid sequence from region 1-363.

Product Specifications

Product Name Alternative

G-protein coupled receptor 78

UniProt

Q96P69

Expression Region

1-363

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPGEALLAGLLVMVLAVALLSNALVLLCCAYSAELRTRASGVLLVNLSLGHLLLAALDM PFTLLGVMRGRTPSAPGACQVIGFLDTFLASNAALSVAALSADQWLAVGFPLRYAGRLRP RYAGLLLGCAWGQSLAFSGAALGCSWLGYSSAFASCSLRLPPEPERPRFAAFTATLHAVG FVLPLAVLCLTSLQVHRVARRHCQRMDTVTMKALALLADLHPSVRQRCLIQQKRRRHRAT RKIGIAIATFLICFAPYVMTRLAELVPFVTVNAQWGILSKCLTYSKAVADPFTYSLLRRP FRQVLAGMVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPRPASTHNGSVDTENDSCLQ QTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Serine Peptidase Inhibitor Kazal Type 1 (SPINK1)(Sandwich ELISA) ELISA Kit
MBS2125307-01 24 Strip Well

Mouse Serine Peptidase Inhibitor Kazal Type 1 (SPINK1)(Sandwich ELISA) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine Peptidase Inhibitor Kazal Type 1 (SPINK1)(Sandwich ELISA) ELISA Kit
MBS2125307-02 48 Well

Mouse Serine Peptidase Inhibitor Kazal Type 1 (SPINK1)(Sandwich ELISA) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine Peptidase Inhibitor Kazal Type 1 (SPINK1)(Sandwich ELISA) ELISA Kit
MBS2125307-03 96 Well

Mouse Serine Peptidase Inhibitor Kazal Type 1 (SPINK1)(Sandwich ELISA) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine Peptidase Inhibitor Kazal Type 1 (SPINK1)(Sandwich ELISA) ELISA Kit
MBS2125307-04 5x 96 Well

Mouse Serine Peptidase Inhibitor Kazal Type 1 (SPINK1)(Sandwich ELISA) ELISA Kit

Sign In for Pricing
View Details
Mouse Serine Peptidase Inhibitor Kazal Type 1 (SPINK1)(Sandwich ELISA) ELISA Kit
MBS2125307-05 10x 96 Well

Mouse Serine Peptidase Inhibitor Kazal Type 1 (SPINK1)(Sandwich ELISA) ELISA Kit

Sign In for Pricing
View Details
TRH, Free Acid
CCP1452-01 1 mg

TRH, Free Acid

Sign In for Pricing
View Details