Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 78 (GPR78)

This Recombinant Human G-protein coupled receptor 78 (GPR78) spans the amino acid sequence from region 1-363.

Product Specifications

Product Name Alternative

G-protein coupled receptor 78

UniProt

Q96P69

Expression Region

1-363

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPGEALLAGLLVMVLAVALLSNALVLLCCAYSAELRTRASGVLLVNLSLGHLLLAALDM PFTLLGVMRGRTPSAPGACQVIGFLDTFLASNAALSVAALSADQWLAVGFPLRYAGRLRP RYAGLLLGCAWGQSLAFSGAALGCSWLGYSSAFASCSLRLPPEPERPRFAAFTATLHAVG FVLPLAVLCLTSLQVHRVARRHCQRMDTVTMKALALLADLHPSVRQRCLIQQKRRRHRAT RKIGIAIATFLICFAPYVMTRLAELVPFVTVNAQWGILSKCLTYSKAVADPFTYSLLRRP FRQVLAGMVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPRPASTHNGSVDTENDSCLQ QTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Red mini-centrifuge with 2 rotors
BCM1707 1 pcs, 1 UNIT

Red mini-centrifuge with 2 rotors

Sign In for Pricing
View Details
Rabbit Anti Human NCS1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 200UL
IRBAMLNCS1AP34200UL 200 µL

Rabbit Anti Human NCS1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 200UL

Sign In for Pricing
View Details
Human BCR_ABL (M244V) BAF3 Cell Line
ABC-X0091C 1 Vial

Human BCR_ABL (M244V) BAF3 Cell Line

Sign In for Pricing
View Details
Human IgG (Fc) Antibody : PE
OASB00878-100UG 0.1 mg

Human IgG (Fc) Antibody : PE

Sign In for Pricing
View Details
c-Met, CT (Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, HGFR, SFR) (MaxLight 550)
MBS6487840-01 0.1 mL

c-Met, CT (Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, HGFR, SFR) (MaxLight 550)

Sign In for Pricing
View Details
c-Met, CT (Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, HGFR, SFR) (MaxLight 550)
MBS6487840-02 5x 0.1 mL

c-Met, CT (Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, HGFR, SFR) (MaxLight 550)

Sign In for Pricing
View Details