Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Somatostatin receptor type 5 (Sstr5)

This Recombinant Rat Somatostatin receptor type 5 (Sstr5) spans the amino acid sequence from region 1-363.

Product Specifications

Product Name Alternative

Somatostatin receptor type 5, SS-5-R, SS5-R, SS5R

UniProt

P30938

Expression Region

1-363

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPLSLASTPSWNASAASSGNHNWSLVGSASPMGARAVLVPVLYLLVCTVGLSGNTLVIY VVLRHAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVVSYWPFGSFLCRLVMTLDGIN QFTSIFCLMVMSVDRYLAVVHPLRSARWRRPRVAKMASAAVWVFSLLMSLPLLVFADVQE GWGTCNLSWPEPVGLWGAAFITYTSVLGFFGPLLVICLCYLLIVVKVKAAGMRVGSSRRR RSEPKVTRMVVVVVLVFVGCWLPFFIVNIVNLAFTLPEEPTSAGLYFFVVVLSYANSCAN PLLYGFLSDNFRQSFRKVLCLRRGYGMEDADAIEPRPDKSGRPQATLPTRSCEANGLMQT SRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCTE1 (NM_182539) Human Recombinant Protein
TP306214 20 µg

TCTE1 (NM_182539) Human Recombinant Protein

Sign In for Pricing
View Details
IRF3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D2]
TA500465BM 100 µL

IRF3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D2]

Sign In for Pricing
View Details
Datura Stramonium Lectin (DSL), CF®640R Conjugate
#29100 1x 1 mL

Datura Stramonium Lectin (DSL), CF®640R Conjugate

Sign In for Pricing
View Details
Mouse Bcdin3d activation kit by CRISPRa
GA210155 1 Kit

Mouse Bcdin3d activation kit by CRISPRa

Sign In for Pricing
View Details
RGL2 Mouse Monoclonal Antibody [Clone ID: OTI10F2]
CF808391 100 µg

RGL2 Mouse Monoclonal Antibody [Clone ID: OTI10F2]

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF640R conjugate, 0.1mg/mL
BNC401138-500 1x 500 µL

WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details