Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Somatostatin receptor type 5 (Sstr5)

This Recombinant Rat Somatostatin receptor type 5 (Sstr5) spans the amino acid sequence from region 1-363.

Product Specifications

Product Name Alternative

Somatostatin receptor type 5, SS-5-R, SS5-R, SS5R

UniProt

P30938

Expression Region

1-363

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPLSLASTPSWNASAASSGNHNWSLVGSASPMGARAVLVPVLYLLVCTVGLSGNTLVIY VVLRHAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVVSYWPFGSFLCRLVMTLDGIN QFTSIFCLMVMSVDRYLAVVHPLRSARWRRPRVAKMASAAVWVFSLLMSLPLLVFADVQE GWGTCNLSWPEPVGLWGAAFITYTSVLGFFGPLLVICLCYLLIVVKVKAAGMRVGSSRRR RSEPKVTRMVVVVVLVFVGCWLPFFIVNIVNLAFTLPEEPTSAGLYFFVVVLSYANSCAN PLLYGFLSDNFRQSFRKVLCLRRGYGMEDADAIEPRPDKSGRPQATLPTRSCEANGLMQT SRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(4-Morpholinyl)ethyl 1-Phenylcyclohexane Carboxylate Hydrochloride
TRC-M725060-10MG 10 mg

2-(4-Morpholinyl)ethyl 1-Phenylcyclohexane Carboxylate Hydrochloride

Sign In for Pricing
View Details
Recombinant APEX1 Antibody
RC-4453-01 50 μL

Recombinant APEX1 Antibody

Sign In for Pricing
View Details
Recombinant APEX1 Antibody
RC-4453-02 100 µL

Recombinant APEX1 Antibody

Sign In for Pricing
View Details
Recombinant APEX1 Antibody
RC-4453-03 1 mL

Recombinant APEX1 Antibody

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SIRT1 Antibody Pair Set
E-KAB-0701 50 µL & 100 µg

Human SIRT1 Antibody Pair Set

Sign In for Pricing
View Details