Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Envelope glycoprotein US27 (US27)

This Recombinant Human cytomegalovirus Envelope glycoprotein US27 (US27) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Envelope glycoprotein US27

UniProt

F5HDK1

Expression Region

1-364

Origin

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTSTTTTTNIMLQVSNVTNHTLNSTEIYQLFEYTRFGVWLMCIVGTFLNMLVITTILYY RRKKKSPSDTYICNLAVADLLIVVGLPFFLEYAKHHPKLSREVVCSGLNACFYICLFAGV CFLINLSMDRYCVIVWGVELNRVRNNKRATCWVVIFWILAALMGMPHYLMYSHTNNECVG EFANETSGWFPVFLNTKVNICGYLAPIVLMAYTYNRMVRFIINYVGKWHMQTLHVLLVVV VSFASFWFPFNLALFLESIRLLSGTQNETLQTVITFCLYVGQFLAYVRACLNPGIYILVG TQMRKDMWTTLRVFACCCVKQEIPYQDIDIELQKDIQRRAKHTKRTHYDRKHAPMESGEE EFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-100 1x 100 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 6 (LHK6), CF488A conjugate, 0.1mg/mL
BNC880675-500 1x 500 µL

Cytokeratin 6 (LHK6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF488A conjugate, 0.1mg/mL
BNC881859-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (IGEL/773), CF568 conjugate, 0.1mg/mL
BNC680773-100 1x 100 µL

CD20 (IGEL/773), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF405S conjugate, 0.1mg/mL
BNC040948-500 1x 500 µL

Cytokeratin 5/8 (C-50), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details