Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-27 (sre-27)

This Recombinant Serpentine receptor class epsilon-27 (sre-27) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-27, Protein sre-27

UniProt

O62488

Expression Region

1-364

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIKNMDASTNVPYLWLPIFLYDEPILASQVIASIELILYSICLYIVVVSLKIFVQVRMF HLNFIILVAPFFGIWFELIIGKLITMCYQLSIFSIGNLEIRKFYVLWTDDSNKMLVVNSF EGLELLIIAGFMEYHYMFSVVFGAVAVAIERLAASVLIDNYESTNKIFIPIALTVFFQII AITCSCLALFHKFTIITINGTWIVSCACSSIVFFLVERINLRWKAEMEHPRREKVYTISQ RFQVKENIRALDLGKRLIFSELGTISIIGLIIATLLLELVPPSLVHIAENALFLNPFGIC TVAMYSIPAWKKRYKNAFPSIFCFLMRLKNRKIDVQSMEPLEEFSKRIYEETNIHFAQLN ESWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A4GNT (NM_016161) Human Recombinant Protein
TP762587 50 µg

A4GNT (NM_016161) Human Recombinant Protein

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details
CXorf49 Human qPCR Primer Pair (NM_001145140)
HP228648 200 Reactions

CXorf49 Human qPCR Primer Pair (NM_001145140)

Sign In for Pricing
View Details
Endothelin B Receptor (EDNRB) Human Gene Knockout Kit (CRISPR)
KN204899LP 1 Kit

Endothelin B Receptor (EDNRB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Malaxinic Acid
TRC-M111050-50MG 50 mg

Malaxinic Acid

Sign In for Pricing
View Details