Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable G-protein coupled receptor AH9.4 (AH9.4)

This Recombinant Probable G-protein coupled receptor AH9.4 (AH9.4) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor AH9.4

UniProt

Q10907

Expression Region

1-364

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLQSAYLVMVFTVPIAGVILNTYVLRKLIRVARKSVVRFETTSGLPLAAMSVGDSITL CALLMQAIFHITPKGEVPTVVLSSICKFGIFLIHSTSAFSVWCWFFLSVLRYIAVFHPFK YRTIWRQPRNALKFLAGAVGMFQIYTLIFVTYRQEEKSCGEYDVFHESAFKHVHLLDIFL FYAIPSLLRITLDFLVLIHCYSPFSVEGLDRVTIDRRYAISGPATTKRFSHTGETDTLDN KAHVALAISITASTNTPSVKRIHHGNPKKKTAMVMRSILISVLNLLLNLPSHIFRAWASY DESSLENEIVRTLEPIAQMMYFSQFACNAFYLATSIYETNGSPRNTVISSSNRHVSRCIS DDEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
BNC400525-100 1x 100 µL

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (8C8), CF594 conjugate, 0.1mg/mL
BNC940005-100 1x 100 µL

Bcl-2 (8C8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), Biotin conjugate, 0.1mg/mL
BNCB0204-100 1x 100 µL

Complement C4d (C4D204), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (CR1/802), CF568 conjugate, 0.1mg/mL
BNC680802-100 1x 100 µL

CD35 / CR1 (CR1/802), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (rCTNNB1/2173), CF640R conjugate, 0.1mg/mL
BNC402173-100 1x 100 µL

Catenin, beta (CTNNB1) (rCTNNB1/2173), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details