Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Goat Long-wave-sensitive opsin 1 (OPN1LW)

This Recombinant Goat Long-wave-sensitive opsin 1 (OPN1LW) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Long-wave-sensitive opsin 1, Red cone photoreceptor pigment, Red-sensitive opsin

UniProt

Q95170

Expression Region

1-364

Origin

Capra hircus (Goat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHTWGPQRLAGGQPQANFEESTQGSIFTYTNSNSTRDPFEGPNYHIAPRWVYHLTSAWM VFVVIASVFTNGLVLAATMRFKKLRHPLNWILVNLAIADLAETIIASTISVVNQMYGYFV LGHPLCVVEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLATAGIAFSWIWA AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITCCFIPLSVIILCYL QVWLAIRAVAKQQKESESTQKAEKEVTRMVMVMIFAYCLCWGPYTFFACFAAAHPGYAFH PLVAALPAYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVDDSSELSSVSKTEASSVSS VSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LysoViewTM 488, 1000X in DMSO
#70067 1x 50 µL

LysoViewTM 488, 1000X in DMSO

Sign In for Pricing
View Details
MemBrite® Fix 680/700 Cell Surface Staining Kit, 500 Reactions
#30099 1 Kit

MemBrite® Fix 680/700 Cell Surface Staining Kit, 500 Reactions

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB532654 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
SEC24A Human Gene Knockout Kit (CRISPR)
KN422920 1 Kit

SEC24A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EPCAM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H9]
TA506627BM 100 µL

EPCAM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H9]

Sign In for Pricing
View Details
PLK2 (NM_006622) Human Over-expression Lysate
LC401982 20 µg

PLK2 (NM_006622) Human Over-expression Lysate

Sign In for Pricing
View Details