Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig Medium-wave-sensitive opsin 1 (OPN1MW)

This Recombinant Guinea pig Medium-wave-sensitive opsin 1 (OPN1MW) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 1, Green cone photoreceptor pigment, Green-sensitive opsin, Medium wavelength-sensitive cone opsin

UniProt

Q9R024

Expression Region

1-364

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQRWGPHALSGVQAQDAYEDSTQASLFTYTNSNNTRGPFEGPNYHIAPRWVYHLTSAWM TIVVIASIFTNGLVLVATMRFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFV LGHPLCVVEGYTVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLAIVGIVFSWVWS AVWTAPPIFGWSRYWPYGLKTSCGPDVFSGTSYPGVQSYMMVLMVTCCITPLSIIVLCYL HVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAYCLCWGPYAFFACFATANPGYSFH PLVAALPAYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVEDSSELSSTSRTEASSVSS VSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THAP7 CRISPR/Cas9 KO Plasmid (h)
sc-413398 20 µg

THAP7 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Biotinylated Human TSLP Protein, C-10*His-Avi
AHJ36101 100 μg

Biotinylated Human TSLP Protein, C-10*His-Avi

Sign In for Pricing
View Details
Anti Mouse CD132 Flow Cytometry Monoclonal Clone 3E12 Biotin 100ug
IRTAMSCD1323E12CBL100UG 100 µg

Anti Mouse CD132 Flow Cytometry Monoclonal Clone 3E12 Biotin 100ug

Sign In for Pricing
View Details
Ube2L6 Rabbit Polyclonal Antibody (Cy3)
orb981044 100 µL

Ube2L6 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
CKB (1-381aa) Monoclonal Antibody
E53M01182 100 µL

CKB (1-381aa) Monoclonal Antibody

Sign In for Pricing
View Details
Ring finger protein 20 Rabbit Monoclonal Antibody
E46F1306 40 µL

Ring finger protein 20 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details