Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Somatostatin receptor type 5 (SSTR5)

This Recombinant Human Somatostatin receptor type 5 (SSTR5) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Somatostatin receptor type 5, SS-5-R, SS5-R, SS5R

UniProt

P35346

Expression Region

1-364

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ TSKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABI3 Human Gene Knockout Kit (CRISPR)
KN402853 1 Kit

ABI3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bmi1 Mouse Gene Knockout Kit (CRISPR)
KN502190 1 Kit

Bmi1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BactoViewTM Dead 690/710 Trial Size
#40112-T 1x 20 µL

BactoViewTM Dead 690/710 Trial Size

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS715411 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF640R conjugate, 0.1mg/mL
BNC401825-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TSGA10 Polyclonal Antibody
E-AB-53009-01 20 µL

TSGA10 Polyclonal Antibody

Sign In for Pricing
View Details