Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lysophosphatidic acid receptor 1 (Lpar1)

This Recombinant Mouse Lysophosphatidic acid receptor 1 (Lpar1) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Lysophosphatidic acid receptor 1, LPA receptor 1, LPA-1, Lysophosphatidic acid receptor Edg-2, Rec1.3, VZG-1

UniProt

P61793

Expression Region

1-364

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVC VFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA IPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS RHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA EFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSND HSVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHMT1 Antibody
KC-1263-01 50 μL

SHMT1 Antibody

Sign In for Pricing
View Details
SHMT1 Antibody
KC-1263-02 100 µL

SHMT1 Antibody

Sign In for Pricing
View Details
SHMT1 Antibody
KC-1263-03 1 mL

SHMT1 Antibody

Sign In for Pricing
View Details
Trmt44 Mouse Gene Knockout Kit (CRISPR)
KN518267 1 Kit

Trmt44 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eph receptor B6 (EPHB6) Mouse Monoclonal Antibody [Clone ID: 2A6B9]
AM06213SU-N 100 µL

Eph receptor B6 (EPHB6) Mouse Monoclonal Antibody [Clone ID: 2A6B9]

Sign In for Pricing
View Details
1,3-Glyceryl Dilinoleate (>80%)
TRC-G601520-250MG 250 mg

1,3-Glyceryl Dilinoleate (>80%)

Sign In for Pricing
View Details