Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Long-wave-sensitive opsin 1 (OPN1LW)

This Recombinant Cat Long-wave-sensitive opsin 1 (OPN1LW) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Long-wave-sensitive opsin 1, Red cone photoreceptor pigment, Red-sensitive opsin

UniProt

O18913

Expression Region

1-364

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQRWGPQRLAGGQPHAGLEDSTRASIFTYTNSNATRGPFEGPNYHIAPRWVYHVTSAWM IFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETIIASTISVVNQIYGYFV LGHPMCVLEGYTVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLAIAGIAFSWIWA AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITCCIIPLSVIVLCYL QVWLAIRAVAKQQKESESTQKAEKEVTRMVMVMIFAYCVCWGPYTFFACFAAAHPGYAFH PLVAALPAYFAKSATIYNPIIYVFMNRQFRNCIMQLFGKKVDDGSELSSASRTEASSVSS VSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD2AP Antibody (Biotin)
KB-8220-01 50 μL

CD2AP Antibody (Biotin)

Sign In for Pricing
View Details
CD2AP Antibody (Biotin)
KB-8220-02 100 µL

CD2AP Antibody (Biotin)

Sign In for Pricing
View Details
CD2AP Antibody (Biotin)
KB-8220-03 1 mL

CD2AP Antibody (Biotin)

Sign In for Pricing
View Details
TIM 3 Recombinant Chimeric Antibody Antibody
HA610277 100 µg

TIM 3 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Pygb Mouse Gene Knockout Kit (CRISPR)
KN514289 1 Kit

Pygb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CAAP1 (NM_024828) Human Recombinant Protein
TP310037L 1 mg

CAAP1 (NM_024828) Human Recombinant Protein

Sign In for Pricing
View Details