Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Long-wave-sensitive opsin 1 (OPN1LW)

This Recombinant Cat Long-wave-sensitive opsin 1 (OPN1LW) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Long-wave-sensitive opsin 1, Red cone photoreceptor pigment, Red-sensitive opsin

UniProt

O18913

Expression Region

1-364

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQRWGPQRLAGGQPHAGLEDSTRASIFTYTNSNATRGPFEGPNYHIAPRWVYHVTSAWM IFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETIIASTISVVNQIYGYFV LGHPMCVLEGYTVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLAIAGIAFSWIWA AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITCCIIPLSVIVLCYL QVWLAIRAVAKQQKESESTQKAEKEVTRMVMVMIFAYCVCWGPYTFFACFAAAHPGYAFH PLVAALPAYFAKSATIYNPIIYVFMNRQFRNCIMQLFGKKVDDGSELSSASRTEASSVSS VSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bad Rabbit Polyclonal Antibody
R1511-32 100 µL

Bad Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD8 Mouse Monoclonal Antibody [Clone ID: CT-8]
AM08116RP-N 100 µg

CD8 Mouse Monoclonal Antibody [Clone ID: CT-8]

Sign In for Pricing
View Details
USP17L3 Human Gene Knockout Kit (CRISPR)
KN432939 1 Kit

USP17L3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IL-33 Antibody Pair Set
E-KAB-0203 50 µL & 100 µg

Human IL-33 Antibody Pair Set

Sign In for Pricing
View Details
NCALD (NM_001040630) Human Recombinant Protein
TP306321M 100 µg

NCALD (NM_001040630) Human Recombinant Protein

Sign In for Pricing
View Details
Pyridin-3-ylacetaldehyde Bisulfate Adduct (~90%)
TRC-P991758-250MG 250 mg

Pyridin-3-ylacetaldehyde Bisulfate Adduct (~90%)

Sign In for Pricing
View Details